DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CG2852

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster


Alignment Length:179 Identity:38/179 - (21%)
Similarity:69/179 - (38%) Gaps:48/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 QIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAI---VFNRALAPIWMEGRLAM 308
            :::.||.: .....||:.|.||.:..|:.|..|..:..:......   .|:|.:....::|    
  Fly    30 KVFFDITI-GGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQG---- 89

  Fly   309 DPQRSTELTN--------------IEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPL 359
                 .:.|.              .:.:|::.::|  ||.||..:   .|.......|.|:.|..
  Fly    90 -----GDFTKGDGTGGRSIYGERFEDENFKLKHYG--AGWLSMAN---AGKDTNGSQFFITTKQT 144

  Fly   360 SILNGRRIAFGKVRKGMQLLERIQVAV----------------GHLPMS 392
            |.|:||.:.|||:..||.::.:|:.:.                |.||:|
  Fly   145 SWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 34/171 (20%)
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.