DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and cyp33

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:341 Identity:59/341 - (17%)
Similarity:117/341 - (34%) Gaps:85/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NEQRELY-----RQHRDRMSNIKGKVNTYLP---PPKVQIEGNGMELSYMEMLTALYKKSNNTLR 157
            |::|.:|     .:..:|:.|     |.::|   ...:|:..:.....:.......|::|.:...
  Fly     3 NDKRTIYVGGLADEVTERLLN-----NAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAA 62

  Fly   158 TFTKSPERLAAGRWRNANLAREKERRQ------------LEKNKEFHKGGEL---FDPEAGKSKR 207
            ......:....||....|||:....::            |:|    |.|..|   .:|||   ::
  Fly    63 AIDNMNDSELCGRTIRVNLAKPVRVKEDSFKPIWADDDWLQK----HAGATLQPEGEPEA---EK 120

  Fly   208 YKPKSSGSFSCEIPMHVLHRYENLMDQCDVGVLCKLLRPQIYLDIEV--REARIQGRLIIQLFTE 270
            .:..|:|.       .|:.:.|.             ..||::.||.:  .:|   ||:::.|..:
  Fly   121 VETPSTGP-------AVIEKAEK-------------RNPQVFFDIRIGGNDA---GRIVMLLRAD 162

  Fly   271 ACPQVVLEFMRICTQNNS---SAIVFNRALAPIWME-----------GRLAMDPQRSTELTNIEH 321
            ..|:....|.::||....   ....|:|.:.....:           |:.....:.:.|..|::|
  Fly   163 VVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKH 227

  Fly   322 DFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAV 386
            :        ..|.||..:.....|..   .|.|.......|:.:.:.||.|..|.:::.:::...
  Fly   228 N--------SFGTLSMANSGANTNGS---QFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCG 281

  Fly   387 GHLPMSHNLISLTDCG 402
            .........|.:..||
  Fly   282 SKSGTPSQKIVIYSCG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 27/154 (18%)
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793 10/76 (13%)
cyclophilin_ABH_like 139..297 CDD:238907 30/171 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.