DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Ppial4g

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_341364.2 Gene:Ppial4g / 361080 RGDID:1559682 Length:195 Species:Rattus norvegicus


Alignment Length:155 Identity:38/155 - (24%)
Similarity:61/155 - (39%) Gaps:23/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GRLIIQLFTEACPQVVLEFMRICT------QNNSSAIVFNRALAPIWMEGRLAM----DPQRSTE 315
            ||:.::||.:..|:....|..:.|      ...||   |:|.:.....:|....    ...:|..
  Rat    18 GRVSLELFADKVPRTAENFRSLTTGEKGFGYKGSS---FHRIIPGFMCQGGKVTCHNGTGGKSIY 79

  Fly   316 LTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVN---FTISFKPLSILNGRRIAFGKVRKGMQ 377
            ....|:|..:|.| ...||||.      .||....|   |.|.......|:|:.:.|||.|.|..
  Rat    80 GEKFENDSFILKH-TGPGILSM------ANAGPNTNGSQFFICTAKTERLDGKCVVFGKGRGGTN 137

  Fly   378 LLERIQVAVGHLPMSHNLISLTDCG 402
            ::|.::........:...|:::|||
  Rat   138 IVEAMEHFGSRNGKTSKKITISDCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 34/139 (24%)
Ppial4gXP_341364.2 cyclophilin 7..162 CDD:294131 36/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.