DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CG17266

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:176 Identity:40/176 - (22%)
Similarity:75/176 - (42%) Gaps:30/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQN--------NSSAIVFNRALAPIWM 302
            |.::.||.|....| ||:|.:||.:..|:....|.:.||..        ......|:|.:....:
  Fly    17 PVVFFDIAVGTTEI-GRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMI 80

  Fly   303 EGRLAMDPQRSTELTNI------EHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSI 361
            :|...:... .|.:|:|      :.:| .|.|. ..|:||..:   .|.......|.|:....:.
  Fly    81 QGGDFVQGD-GTGVTSIYGNTFGDENF-TLKHD-SPGLLSMAN---SGKETNGCQFFITCAKCNF 139

  Fly   362 LNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHN-----LISLTDCG 402
            |:|:.:.||:|..|:.::.:|:    ::|...|     .::::.||
  Fly   140 LDGKHVVFGRVLDGLLIMRKIE----NVPTGPNNKPKLPVTISQCG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 35/152 (23%)
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.