DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Cyp1

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster


Alignment Length:158 Identity:32/158 - (20%)
Similarity:67/158 - (42%) Gaps:38/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS---SAIVFNRALAPIWMEGRLA 307
            |:::.|:......: ||::::|.::..|:....|..:||....   ...:|:|.:.....:|   
  Fly    67 PRVFFDMTADNEPL-GRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQG--- 127

  Fly   308 MDPQRSTELTN--------------IEHDFEVLNHGVDAGILSFPSRYVRGNARTAVN---FTIS 355
                  .:.||              .:.:||:.:.|  :||||.      .||....|   |.|.
  Fly   128 ------GDFTNHNGTGGKSIYGNKFPDENFELKHTG--SGILSM------ANAGANTNGSQFFIC 178

  Fly   356 FKPLSILNGRRIAFGKVRKGMQLLERIQ 383
            ....:.|:.:.:.||:|.:|:.::::|:
  Fly   179 TVKTAWLDNKHVVFGEVVEGLDVVKKIE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 31/155 (20%)
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 32/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.