DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CG15767

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster


Alignment Length:354 Identity:90/354 - (25%)
Similarity:153/354 - (43%) Gaps:67/354 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KRQELENNYRHHQRLIPVPTSRRTMP-----KIRSHI-VMNEQRELYRQHRD----------RMS 115
            :|.:|..|..:.|||....:.....|     |.:|.. |::|...::.:..:          ::.
  Fly    26 RRVQLSRNKLYLQRLSRATSLVHKRPPLMNVKTQSGFDVLHEDARIFLERTNANVRLLLNLSKIK 90

  Fly   116 NIKGKVNTYLPPPKVQIEGNGMELSYMEMLTALYKKSNNTLRTFTKSPERLAAGRWRNANLAREK 180
            ..||.::....||.:.      :.:..:||..|.:...:.|              |....|.|..
  Fly    91 RTKGTIDFVEGPPLIP------QSALPQMLQRLDRVQRHNL--------------WLGLRLMRIH 135

  Fly   181 ERRQLEKNKEFHKGGELFDPEAGKSKRYKPKSSGSFSCEIPMHVLHRY---ENLMDQCDVG---- 238
            ||:         :.|:....|..:.||...:|..| :...|..:.:|.   ||.:....:|    
  Fly   136 ERK---------REGDQRKREGDQQKRISEQSQSS-NLRCPSTITNRSTLGENEVFNKYIGWDLD 190

  Fly   239 ------VLCKLLRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRAL 297
                  .|.:||||:|.|...:.:.|..|::::||:|||.|.|||:|:|.|....|......|..
  Fly   191 MPDEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEFAVRRIF 255

  Fly   298 APIWMEGRLAMDPQRST-ELTNI------EHDFEVLNHGVDAGILSFPSRY-VRGNARTAVNFTI 354
            ..:|:||.|....:.|. |.:::      |.|..|::|...|.:||....| |.|....|:||:|
  Fly   256 PRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSI 320

  Fly   355 SFKPLSILNGRRIAFGKVRKGMQLLERIQ 383
            |||||.:..|:|:.||:|.:|.:::|.::
  Fly   321 SFKPLPVARGQRVGFGRVIRGDKVIEAME 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 49/143 (34%)
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.