DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Ppil3

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_783638.1 Gene:Ppil3 / 301432 RGDID:631415 Length:161 Species:Rattus norvegicus


Alignment Length:150 Identity:33/150 - (22%)
Similarity:60/150 - (40%) Gaps:40/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRAL-----------------APIWMEGRLAM 308
            |.:.|::|.|..|:....|:.:|..|..:..||:|.:                 :.||  |:   
  Rat    10 GDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIW--GK--- 69

  Fly   309 DPQRSTELTNIEHDF-EVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKV 372
                     ..|.:: |.|.|.| .|::|..:   .|.......|.|::.....|:.:...||||
  Rat    70 ---------KFEDEYSEYLKHNV-RGVVSMAN---NGPNTNGSQFFITYGKQPHLDMKYTVFGKV 121

  Fly   373 RKGMQLLERIQVAVGHLPMS 392
            ..|::.|:.::    .||::
  Rat   122 IDGLETLDELE----KLPVN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 31/144 (22%)
Ppil3NP_783638.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 33/149 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.