Sequence 1: | NP_611914.1 | Gene: | CG3492 / 37902 | FlyBaseID: | FBgn0035007 | Length: | 404 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104768.2 | Gene: | PPIL6 / 285755 | HGNCID: | 21557 | Length: | 337 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 42/209 - (20%) |
---|---|---|---|
Similarity: | 83/209 - (39%) | Gaps: | 57/209 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 242 KLLRPQ----IYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICT-------------QNNSS 289
Fly 290 AIVFNRALAPIWME------------------------GRLAMDPQRSTELTNI-------EHDF 323
Fly 324 EVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGH 388
Fly 389 LPMSHNLISLTDCG 402 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3492 | NP_611914.1 | cyclophilin | 249..388 | CDD:294131 | 36/182 (20%) |
PPIL6 | NP_001104768.2 | cyclophilin | 144..333 | CDD:412213 | 38/197 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |