DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and cyp4

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_596532.1 Gene:cyp4 / 2541395 PomBaseID:SPBP8B7.25 Length:201 Species:Schizosaccharomyces pombe


Alignment Length:155 Identity:31/155 - (20%)
Similarity:60/155 - (38%) Gaps:32/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 IYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS---SAIVFNRALAPIWMEGRLAMD 309
            :|.|::..: ...||:.|.||.:..|:....|..:.|....   ...:|:|.:....::|     
pombe    29 VYFDLQQGD-EFLGRVTIGLFGKTVPKTAENFRALATGEKGFGYEGSIFHRVIPNFMIQG----- 87

  Fly   310 PQRSTELTN--------------IEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLS 360
                .::|.              .:.:|: |:| ...|:||..:   .|.......|.|:.....
pombe    88 ----GDITKGDGTGGKSIYGSRFPDENFK-LSH-QRPGLLSMAN---AGPDSNGSQFFITTVKTP 143

  Fly   361 ILNGRRIAFGKVRKGMQLLERIQVA 385
            .|:|..:.||:|..|..::::|..|
pombe   144 WLDGHHVVFGEVLSGYDIVKKISKA 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 31/154 (20%)
cyp4NP_596532.1 cyclophilin 27..186 CDD:294131 31/155 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.