DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and cyp7

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001342715.1 Gene:cyp7 / 2540067 PomBaseID:SPBC16H5.05c Length:463 Species:Schizosaccharomyces pombe


Alignment Length:123 Identity:27/123 - (21%)
Similarity:52/123 - (42%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 QGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQRSTELTNIEHDFE 324
            :|.:.|:|:.:..|:....|:::|.:......:.:|.:....::|.   ||      |......|
pombe    21 RGDIQIELWCKEVPKACRNFIQLCLEGYYDGTIVHRVVPEFLIQGG---DP------TGTGMGGE 76

  Fly   325 VLNHGVDAGILSFPS-RYVR----GNARTA-----VNFTISFKPLSILNGRRIAFGKV 372
            .: :|....:.:.|. |::|    |.|.|.     ..|.|:..|....||::..||:|
pombe    77 SI-YGEPFAVETHPRLRFIRRGLVGMACTENEGNNSQFFITLGPTPEWNGKQTLFGRV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 27/123 (22%)
cyp7NP_001342715.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 27/123 (22%)
TOP2c <143..390 CDD:330395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.