DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CG30350

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:352 Identity:101/352 - (28%)
Similarity:163/352 - (46%) Gaps:65/352 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KIRSHIVMNEQRELYRQHRDR----------------------MSNIKGKVNTYLPPPKVQIEGN 135
            ||...::|....:::.|||:|                      ::|::.:..|::...|..|:  
  Fly    43 KILGGLLMVNHMKMWHQHRERIKGAISTVDAEAPNFQAARITGVNNLRDEAQTFMKRTKANIQ-- 105

  Fly   136 GMELSYMEMLTALYKKSNNTLRTF-TKSPERL----AAGRWRNANLAREK--------ERRQLEK 187
                        |..:.:.|:||. ..:|.|.    |......|.|..||        .||.||.
  Fly   106 ------------LLVEISRTMRTHGAINPFRYDTVHAVSSIPMALLTLEKLERDNRDFGRRILEV 158

  Fly   188 NKEFHKGGELFDPEAGKSKRYKPKSSGSFSCEIPMHVLHRYE--NLMDQCDVGVLCKLLRPQIYL 250
            |.|...|  |.|    |..|....|:.....|:|...:.:||  |:........|.:|.||:||.
  Fly   159 NSEVDSG--LSD----KRMREGRSSTPVAPLELPPQAMAKYEAFNIPLPKSDAELRRLFRPRIYF 217

  Fly   251 DIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQRSTE 315
            |:.:::||..||.::||:|||.|.|||:.::.|..|..|..:..|....:|:|..|.:.   |..
  Fly   218 DLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLMLS---SDS 279

  Fly   316 LTN--IEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQL 378
            |.:  :|:|.:|::||..:.:|||...||.|... .::|.||||||:::||.|:.||::.||.::
  Fly   280 LLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTH-HLSFAISFKPLTVVNGSRVGFGRIVKGSKI 343

  Fly   379 LERIQ-VAVGHLPMSHNLISLTDCGVI 404
            .|.|| ....:..:|..|: .|.||::
  Fly   344 CECIQSYGTKNGKLSRGLL-FTSCGLL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 52/141 (37%)
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 19/108 (18%)
cyclophilin 212..369 CDD:294131 60/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470613
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.