DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and PPIL2

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_011528343.1 Gene:PPIL2 / 23759 HGNCID:9261 Length:616 Species:Homo sapiens


Alignment Length:449 Identity:91/449 - (20%)
Similarity:153/449 - (34%) Gaps:136/449 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DAPQASRGKIP--QIPSSMTPYVAAVKRGPYTMTNP---------------VYNTHNPNLVGLDG 53
            |.||.:..::|  ....|:.|:|       |.:..|               .|.|:..|...|||
Human    28 DLPQTNFRRLPFDHCSLSLQPFV-------YPVCTPDGIVFDLLNIVPWLKKYGTNPSNGEKLDG 85

  Fly    54 QVEDSRPKHTFNVKRQELENNYRHHQRLIPVPTSRRTMPKIRSHIV-MNEQRELYRQHRDRMSNI 117
            :   |..|..|:   :..|..| |...|..|.|:       .:||| :.....:|........||
Human    86 R---SLIKLNFS---KNSEGKY-HCPVLFTVFTN-------NTHIVAVRTTGNVYAYEAVEQLNI 136

  Fly   118 KGKVNTYLPPPKVQIEGNGMELSYMEMLT----------ALYKKSN-------------NTLRTF 159
            |.|                   ::.::||          .|...:|             |.::..
Human   137 KAK-------------------NFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMKII 182

  Fly   160 TKSPERL---AAGRWRNANLAREKERRQLEKNKEFHKGGELF-----DPEAGKSKRYKP------ 210
            ....|:.   .:...:|.| |..:|..| |..||| ||.|:.     .||..|..:...      
Human   183 DPDEEKAKQDPSYYLKNTN-AETRETLQ-ELYKEF-KGDEILAATMKAPEKKKVDKLNAAHYSTG 244

  Fly   211 KSSGSF-SCEIPMHVLHRYENLMDQCDVGVL-CKLLRPQIYLDIEVREARIQGRLIIQLFTEACP 273
            |.|.|| |..:.....|....:    |..|| .:.::.:.|:.:...    :|.|.::|..:..|
Human   245 KVSASFTSTAMVPETTHEAAAI----DEDVLRYQFVKKKGYVRLHTN----KGDLNLELHCDLTP 301

  Fly   274 QVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQ--------------RSTELTNIEHDFE 324
            :....|:|:|.::.....:|:|::....::|.   ||.              :.....|:.|   
Human   302 KTCENFIRLCKKHYYDGTIFHRSIRNFVIQGG---DPTGTGTGGESYWGKPFKDEFRPNLSH--- 360

  Fly   325 VLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQ 383
                 ...||||..:.....|..   .|.|:|:..:.|:.:...||:|..|..:|..::
Human   361 -----TGRGILSMANSGPNSNRS---QFFITFRSCAYLDKKHTIFGRVVGGFDVLTAME 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 29/149 (19%)
PPIL2XP_011528343.1 RING-Ubox_PPIL2 38..110 CDD:319577 19/85 (22%)
RING_Ubox 100..159 CDD:388418 15/85 (18%)
U-box domain, a modified RING finger 103..146 CDD:319361 11/68 (16%)
cyclophilin_RING 281..440 CDD:238904 29/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.