DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Nktr

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_030099969.1 Gene:Nktr / 18087 MGIID:97346 Length:1556 Species:Mus musculus


Alignment Length:202 Identity:45/202 - (22%)
Similarity:74/202 - (36%) Gaps:73/202 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS-----------SAIVFNRALA 298
            |||.:.|||:....: ||::.|||::.||:....|:.:|:....           ....|:|.:.
Mouse   108 RPQCHFDIEINREPV-GRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVK 171

  Fly   299 PIWMEGRLAMDPQRSTELTNIEHDFE--------------------VLNHGVDAGILSFPSRYVR 343
            ...::|                .||.                    :|.|. .|.:||..:   |
Mouse   172 NFMIQG----------------GDFSEGNGKGGESIYGGYFKDENFILKHD-RAFLLSMAN---R 216

  Fly   344 GNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNL-----------IS 397
            |.......|.|:.||...|:|..:.||.|..|.:::|:|:          ||           :.
Mouse   217 GKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIE----------NLKTDAASRPYADVR 271

  Fly   398 LTDCGVI 404
            :.||||:
Mouse   272 VIDCGVL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 36/169 (21%)
NktrXP_030099969.1 cyclophilin 109..276 CDD:381853 41/197 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.