DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and cyn-16

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_496562.3 Gene:cyn-16 / 174843 WormBaseID:WBGene00000892 Length:483 Species:Caenorhabditis elegans


Alignment Length:153 Identity:33/153 - (21%)
Similarity:57/153 - (37%) Gaps:39/153 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQRSTELTNIEHDF-- 323
            |.:.|:|:|:..|.....|:::|.:|.....||:|.:....::|.   ||..:.  |..|..:  
 Worm    22 GDIEIELWTKEAPLACRNFIQLCMENYYKGTVFHRLVKNFILQGG---DPTATG--TGGESIYGK 81

  Fly   324 ----EVLNHGVDAGILSFPSRYVRGNARTAVN-------FTISFKPLSILNGRRIAFGKVRKGMQ 377
                |:...      |.|..|.:.|.|....:       |||..:....|:.:...||||..   
 Worm    82 PFKDEIHQR------LKFNRRGIVGMANAGRDDNGSQFFFTIGDRGAPELDKKHTIFGKVTG--- 137

  Fly   378 LLERIQVAVGHLPMSHNLISLTD 400
                        |...|::.:|:
 Worm   138 ------------PTLFNMLKITE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 30/139 (22%)
cyn-16NP_496562.3 cyclophilin_CeCYP16-like 8..175 CDD:238906 33/153 (22%)
PRK14906 258..>353 CDD:184899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.