DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and cyn-11

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_495855.1 Gene:cyn-11 / 174394 WormBaseID:WBGene00000887 Length:183 Species:Caenorhabditis elegans


Alignment Length:176 Identity:41/176 - (23%)
Similarity:74/176 - (42%) Gaps:30/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICT--------QNNSSAIVFNRALAPIWM 302
            |.::|::....|.| |.::|:||.:..|:....|.:.||        .|......|:|.:....:
 Worm    17 PIVFLEVTAGGAPI-GTIVIELFADVTPRTAENFRQFCTGEYKKDGVPNGYKNCTFHRVIKDFMI 80

  Fly   303 EGRLAMDPQRSTELTNI------EHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSI 361
            :|....:.. .|.|.:|      :.:|| |.| :..|:||..:   .|:......|.|:......
 Worm    81 QGGDFCNGD-GTGLMSIYGSKFRDENFE-LKH-IGPGMLSMAN---AGSDTNGCQFFITCAKTDF 139

  Fly   362 LNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHN-----LISLTDCG 402
            |:.:.:.||:|..||..:.:|:    ::|...|     .|.:..||
 Worm   140 LDNKHVVFGRVLDGMLTVRKIE----NVPTGANNKPKLPIVVVQCG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 35/152 (23%)
cyn-11NP_495855.1 cyclophilin 12..183 CDD:294131 41/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.