DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and AgaP_AGAP009996

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_319139.2 Gene:AgaP_AGAP009996 / 1279422 VectorBaseID:AGAP009996 Length:161 Species:Anopheles gambiae


Alignment Length:132 Identity:31/132 - (23%)
Similarity:60/132 - (45%) Gaps:18/132 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAM--DPQ------RSTELT 317
            |.:.|:||.:.||:....|:.:|..:..:..:|:|.:     :|.:..  ||.      :|....
Mosquito    10 GDIKIELFCDDCPKTCENFLALCASDYYNGNLFHRNI-----KGFIVQTGDPTGTGKGGQSIWKR 69

  Fly   318 NIEHDF-EVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLER 381
            ..|.:| |.|.|. :.|::|..:.....|. :...||.:.:|  .|:.:...||:|..|.:.|:.
Mosquito    70 KFEDEFKENLKHN-ERGMVSMANSGPNTNG-SQFFFTYAAQP--ALDLKYTLFGQVIDGFEALDE 130

  Fly   382 IQ 383
            ::
Mosquito   131 LE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 31/132 (23%)
AgaP_AGAP009996XP_319139.2 Cyclophilin_PPIL3_like 2..154 CDD:238909 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.