DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and AgaP_AGAP008136

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_317325.4 Gene:AgaP_AGAP008136 / 1277821 VectorBaseID:AGAP008136 Length:676 Species:Anopheles gambiae


Alignment Length:165 Identity:32/165 - (19%)
Similarity:64/165 - (38%) Gaps:42/165 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRAL-----------------APIWMEGRLAM 308
            |.:.:.||.:..|:..|.|:::|.....:..:|:...                 :.:|  |.|..
Mosquito    10 GDITVDLFLKERPRAALNFLKLCKLKYYNYNLFHTIQSDFIAQTGDPTGAGDGGSSVW--GILEG 72

  Fly   309 DPQRSTE---LTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKP-LSILNGRRIAF 369
            ..:|..|   :..|:|.        :.|:||..:   .|.......|..:..| |:.|:||....
Mosquito    73 AEKRYFEGESVPKIKHS--------EPGLLSMVN---AGEHLIGSQFFFTLGPDLTSLDGRHTVI 126

  Fly   370 GKVRKGMQLLERIQVAV---GHLP-----MSHNLI 396
            |:|.:|.::|.::...:   .|.|     ::|.::
Mosquito   127 GEVTEGHEVLRKLNEVICDDRHRPYKDVRITHTVV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 29/150 (19%)
AgaP_AGAP008136XP_317325.4 cyclophilin_RRM 4..169 CDD:238902 32/165 (19%)
RRM <237..>323 CDD:223796
RRM_PPIL4 237..319 CDD:240681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.