DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and AgaP_AGAP007704

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_308172.4 Gene:AgaP_AGAP007704 / 1269530 VectorBaseID:AGAP007704 Length:507 Species:Anopheles gambiae


Alignment Length:173 Identity:39/173 - (22%)
Similarity:67/173 - (38%) Gaps:40/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 DIEVREARIQGRLI---------IQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRL 306
            :|.::|....|:::         |:|:::.||.....|:::|.:...:..:|:|.:....::|. 
Mosquito     3 NIYIQEPPTSGKVLLKTSVGDIDIELWSKECPLACRNFIQLCLEGYYNGTIFHRVVKGFIVQGG- 66

  Fly   307 AMDPQRSTELTNIE----HDFEVLNHGVDAGILSFPSRYVR---------GNARTAVNFTISFKP 358
              ||  :.:.|..|    |.|:...|.        ..||||         |....|..|..:..|
Mosquito    67 --DP--NGDGTGGESVYGHPFKDEFHS--------RLRYVRRGLVGMANSGRNDNASQFFFTMGP 119

  Fly   359 LSILNGRRIAFGKVR----KGMQLLERIQVAVGHLP-MSHNLI 396
            ...|..:...||||.    ..|..||..:|.....| .:|.:|
Mosquito   120 TPELQNQNTLFGKVAGDTIYNMLKLEEGEVYENERPHFTHRII 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 36/162 (22%)
AgaP_AGAP007704XP_308172.4 cyclophilin_CeCYP16-like 8..177 CDD:238906 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.