Sequence 1: | NP_611914.1 | Gene: | CG3492 / 37902 | FlyBaseID: | FBgn0035007 | Length: | 404 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_307775.3 | Gene: | AgaP_AGAP003265 / 1269170 | VectorBaseID: | AGAP003265 | Length: | 382 | Species: | Anopheles gambiae |
Alignment Length: | 202 | Identity: | 42/202 - (20%) |
---|---|---|---|
Similarity: | 66/202 - (32%) | Gaps: | 76/202 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 246 PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDP 310
Fly 311 QRSTEL-----------------------------------TNIEHDFEVLNHGVDAGILSFPSR 340
Fly 341 YVRGNART-AVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHN-------LIS 397
Fly 398 LTDCGVI 404 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3492 | NP_611914.1 | cyclophilin | 249..388 | CDD:294131 | 34/174 (20%) |
AgaP_AGAP003265 | XP_307775.3 | TPR_11 | 289..350 | CDD:290150 | |
TPR repeat | 319..347 | CDD:276809 | |||
TPR_1 | 320..352 | CDD:278916 | |||
cyclophilin | 20..186 | CDD:294131 | 39/198 (20%) | ||
TPR repeat | 282..314 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |