DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and AgaP_AGAP003265

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_307775.3 Gene:AgaP_AGAP003265 / 1269170 VectorBaseID:AGAP003265 Length:382 Species:Anopheles gambiae


Alignment Length:202 Identity:42/202 - (20%)
Similarity:66/202 - (32%) Gaps:76/202 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDP 310
            |.:|||::|.|..: ||::|:|..:..|:....|..:||                   |...:.|
Mosquito    20 PLVYLDVKVGEESV-GRIVIELRADVVPRTAENFRALCT-------------------GERGIAP 64

  Fly   311 QRSTEL-----------------------------------TNIEHDFEVLNHGVDAGILSFPSR 340
            ...|.|                                   |..:.:|.:|:   :.|.:|..: 
Mosquito    65 DTGTRLHYKGSPFHRVKSLFMSQGGDIVHFNGTGGESIYGKTFEDENFTLLH---EDGAVSMAN- 125

  Fly   341 YVRGNART-AVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHN-------LIS 397
              .|.|.| ...|.|:......|||..:..|.|.:|..:       ||.:....|       .|.
Mosquito   126 --LGKAHTNNSQFFITSGECPHLNGTNVVVGYVIRGGGI-------VGEMERHSNDDGDPLVPIV 181

  Fly   398 LTDCGVI 404
            :.|||.|
Mosquito   182 IEDCGQI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 34/174 (20%)
AgaP_AGAP003265XP_307775.3 TPR_11 289..350 CDD:290150
TPR repeat 319..347 CDD:276809
TPR_1 320..352 CDD:278916
cyclophilin 20..186 CDD:294131 39/198 (20%)
TPR repeat 282..314 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.