DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Ppif

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_598845.1 Gene:Ppif / 105675 MGIID:2145814 Length:206 Species:Mus musculus


Alignment Length:175 Identity:41/175 - (23%)
Similarity:71/175 - (40%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS---SAIVFNRALAPIWM----- 302
            |.:|||:.. :.:..||::::|..:..|:....|..:||....   ....|:|.: |.:|     
Mouse    45 PLVYLDVGA-DGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVI-PAFMCQAGD 107

  Fly   303 -------EGRLAMDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVN---FTISFK 357
                   .||.....:...|...::|        |..|:||.      .||....|   |.|...
Mouse   108 FTNHNGTGGRSIYGSRFPDENFTLKH--------VGPGVLSM------ANAGPNTNGSQFFICTI 158

  Fly   358 PLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNLISLTDCG 402
            ....|:|:.:.||.|::||.::::|:........:...|.:||||
Mouse   159 KTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 35/156 (22%)
PpifNP_598845.1 cyclophilin_ABH_like 45..203 CDD:238907 39/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.