DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CWC27

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_005860.2 Gene:CWC27 / 10283 HGNCID:10664 Length:472 Species:Homo sapiens


Alignment Length:251 Identity:47/251 - (18%)
Similarity:88/251 - (35%) Gaps:63/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GDAPQASRGKIPQIPSSMTPYVAA----VKRGPYTMTNPVYNTHN---PNLVGLDGQVEDSRPKH 62
            |:..:....::.::..||.....:    :|..|:..:.||..:..   |:||. ||  ||...:|
Human   208 GEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVD-DG--EDESAEH 269

  Fly    63 TFNVKRQELENNYRHHQRLIPVPTSRRTMPKIRSHIVMNEQRELYRQH------RDRMSNIK--- 118
                                             ...:..:::.|.|:.      :|..:|:|   
Human   270 ---------------------------------DEYIDGDEKNLMRERIAKKLKKDTSANVKSAG 301

  Fly   119 -GKVNTYLPPPKVQIEGNGMELSYMEMLTALYKKSNNTLRTFTK-SPERLAAGRWRNANLAREKE 181
             |:|.........::.....:|. .|:|.|..||..|..:...| |.|..|......|...|||:
Human   302 EGEVEKKSVSRSEELRKEARQLK-RELLAAKQKKVENAAKQAEKRSEEEEAPPDGAVAEYRREKQ 365

  Fly   182 RRQLEKNKEFHKGGELFDPEAGKSKRYKPKSSGSFSCEIPMHVLHRYENLMDQCDV 237
            :.:..:.::..||....|.......::|.|.:.:.: |.|       ||.:.:.:|
Human   366 KYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAIA-ETP-------ENDIPETEV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131
CWC27NP_005860.2 cyclophilin_CeCYP16-like 8..178 CDD:238906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..386 40/214 (19%)
DUF5401 <302..>472 CDD:375164 27/121 (22%)
CWC27_CTD 376..428 CDD:412084 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..472 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.