DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and ppil6

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_017949805.1 Gene:ppil6 / 100496026 XenbaseID:XB-GENE-979458 Length:304 Species:Xenopus tropicalis


Alignment Length:169 Identity:43/169 - (25%)
Similarity:77/169 - (45%) Gaps:17/169 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 IYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAI----------VFNRALAPIWM 302
            :||||.: :.:..|||:.:||::.||:....|..:||.....::          :|:|.:...|:
 Frog   137 VYLDISI-QGKPVGRLLFELFSDLCPKTCENFQSLCTGAAGVSLSGLKLHYKDSIFHRIVKNGWI 200

  Fly   303 EGRLAMDPQRSTELTNIEHDFEVLNHGV---DAGILSFPSRYVRGNARTAVNFTISFKPLSILNG 364
            :|......:.|...:.....||..|..|   ..|||...:   :|.......|.|:.:|.|.|:.
 Frog   201 QGGDIESGKGSGGESIFGETFEDENFAVPHSKRGILGMAN---KGRHSNGSQFYITLQPTSYLDR 262

  Fly   365 RRIAFGKVRKGMQLLERIQVAVGHLPMSHNLISLTDCGV 403
            |.:|||::.:|..:|:.|:....:.........:||||:
 Frog   263 RCVAFGQLVEGCGVLKEIEDIPTYNERPTTDCKITDCGI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 39/151 (26%)
ppil6XP_017949805.1 cyclophilin 137..300 CDD:381853 41/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.