DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and ppic

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:161 Identity:36/161 - (22%)
Similarity:72/161 - (44%) Gaps:44/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 QIYLDIEV--REARIQGRLIIQLFTEACPQVVLEFMRICTQNNS---SAIVFNRALAPIWMEGRL 306
            :::.::|:  .:|   ||::|.||.:..|:.|..|:.:.|....   ....|:|.:....::|  
 Frog    33 KVFFNVEIGGTDA---GRIVIGLFGKVVPKTVKNFVALATGEKGYGYKGSRFHRVIKDFMIQG-- 92

  Fly   307 AMDPQRSTELTN--------------IEHDFEVLNHGVDAGILSFPSRYVRGNARTAVN----FT 353
                   .::||              .:.:|::.::|:  |.:|.      .||....|    |.
 Frog    93 -------GDVTNGDGTGGKSIYGETFPDENFKLKHYGI--GWVSM------ANAGPDTNGSQFFI 142

  Fly   354 ISFKPLSILNGRRIAFGKVRKGMQLLERIQV 384
            .:.:|| .|||:.:.||||.:||.::..|::
 Frog   143 STTRPL-WLNGKHVVFGKVLEGMAVVHLIEL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 36/159 (23%)
ppicXP_002931773.2 cyclophilin 33..191 CDD:294131 36/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.