DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Ppial4d

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_006250863.1 Gene:Ppial4d / 100360977 RGDID:2321083 Length:164 Species:Rattus norvegicus


Alignment Length:173 Identity:42/173 - (24%)
Similarity:71/173 - (41%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LLRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICT------QNNSSAIVFNRALAPIW 301
            ::.|.::.|| ..:....||:..:||.:..|:....|..:.|      ...||   |:|.:....
  Rat     1 MVNPTVFFDI-TADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSS---FHRIIPGFM 61

  Fly   302 MEG----RLAMDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVN---FTISFKPL 359
            .:|    |......:|......|.:..:|.| ...||||.      .||....|   |.|.....
  Rat    62 CQGGDFTRHNGTGGKSIYGEKFEDENFILKH-TGPGILSM------ANAGPNTNGSQFFICTAKT 119

  Fly   360 SILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNLISLTDCG 402
            ..|:|:.:.||||::||.::|.::........:...|:::|||
  Rat   120 EWLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 37/151 (25%)
Ppial4dXP_006250863.1 cyclophilin_ABH_like 4..162 CDD:238907 40/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.