DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and ranbp2

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_021334470.1 Gene:ranbp2 / 100317326 ZFINID:ZDB-GENE-081104-93 Length:2984 Species:Danio rerio


Alignment Length:400 Identity:80/400 - (20%)
Similarity:148/400 - (37%) Gaps:108/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 THNPNLVGLDGQVEDSRPKHTFNVKRQELENNYRHHQRLIPVPTSRRTMPKIRSHIVMNEQRELY 107
            ||..:    |.:.:|....|:..:          |.:.::.:|.......:....|:..|:..||
Zfish  2651 THRDD----DDEGDDDEAPHSDEI----------HFEPIVSLPEVEVRSGEEDEEILFKERCRLY 2701

  Fly   108 RQHRDRMSNIK----GKVNTYLPPPKVQIE-----------------GNGMELSYMEMLTALYKK 151
            |..|| :...|    |::.....|.|....                 .:|:.|::|.      ..
Zfish  2702 RWDRD-LQQWKERGVGELKILFHPQKKSYRLLMRREQVLKVCANHTISSGITLTHMN------SS 2759

  Fly   152 SNNTLRTFTK------SPERLAAGRWRNANLAREKERRQLEKNKEFHKGGELFDPEAGKSKRYKP 210
            :|..:.|.|.      ..|:||. ::::|:||:...|              :|:           
Zfish  2760 ANALVWTATDYAEGDGKVEQLAV-KFKSADLAQSFRR--------------VFE----------- 2798

  Fly   211 KSSGSFSCEIPMHVLHRYENLMDQCDVGVLCKLLR---PQIYLDIEVREARIQGRLIIQLFTEAC 272
                  .|:       |..:..|...|.:...|.|   |:::.|:.| :....||::::||....
Zfish  2799 ------DCQ-------RCVSQADSAQVSLAETLSRESNPRVFFDVCV-DGEDAGRIVMELFAHIV 2849

  Fly   273 PQVVLEFMRICTQNNS---SAIVFNRALAPIWMEGRLAMDPQRSTELTNI------EHDFEVLNH 328
            |:....|..:||....   |..:|:|.:.....:|. .:..|..|...:|      :..|||.:.
Zfish  2850 PKTAENFRALCTGEKGFGYSGSIFHRIIPDFMCQGG-DITHQDGTGGRSIYGHAFEDESFEVRHT 2913

  Fly   329 GVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERI-QVAVGHLPMS 392
            |  .|:||..:   ||....:..|.::.:....|:.:.:|||.|..|||:|.|: ::.......:
Zfish  2914 G--PGLLSMAN---RGRDSNSSQFFLTLRKAEHLDYKHVAFGFVTDGMQVLRRLAEMGTKEGKPT 2973

  Fly   393 HNLISLTDCG 402
            |. |::..||
Zfish  2974 HT-ITIHHCG 2982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 37/148 (25%)
ranbp2XP_021334470.1 TPR_11 36..>182 CDD:330823
TPR repeat 59..89 CDD:276809
TPR repeat 94..123 CDD:276809
Herpes_BLLF1 <837..1115 CDD:330317
PH-like 1157..1273 CDD:327399
zf-RanBP 1308..1337 CDD:279035
RanBP2-type Zn finger 1312..1331 CDD:275375
zf-RanBP 1370..1399 CDD:279035
RanBP2-type Zn finger 1374..1393 CDD:275375
RanBP2-type Zn finger 1455..1474 CDD:275375
zf-RanBP 1505..1531 CDD:279035
RanBP2-type Zn finger 1509..1528 CDD:275375
zf-RanBP 1546..1575 CDD:279035
RanBP2-type Zn finger 1550..1569 CDD:275375
RanBD2_RanBP2-like 1798..1914 CDD:269998
PH-like 2088..2204 CDD:327399
IR1-M 2381..2440 CDD:314969
IR1-M 2442..>2488 CDD:314969
Epiglycanin_TR 2530..2596 CDD:310328
PH-like 2685..2801 CDD:327399 25/154 (16%)
cyclophilin 2824..2982 CDD:320812 40/165 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.