DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and nktr

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_002939352.1 Gene:nktr / 100145676 XenbaseID:XB-GENE-992970 Length:1394 Species:Xenopus tropicalis


Alignment Length:194 Identity:44/194 - (22%)
Similarity:75/194 - (38%) Gaps:57/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIV-----------FNRALA 298
            |||.|.|:|:....: ||::.|||::.||:..:.|:.:||.......|           |:|.:.
 Frog     6 RPQCYFDVEINREPV-GRIVFQLFSDVCPKTCMNFLCLCTGEKGIGKVTGKKLCYKGSTFHRVVK 69

  Fly   299 PIWMEGRLAMDPQRSTELTNIEHDFE--------------------VLNHGVDAGILSFPSRYVR 343
            ...::|                .||.                    :|.|. .|.:||..:   |
 Frog    70 NFMIQG----------------GDFSEGNGKGGESIYGGYFKDENFILKHD-RAFLLSMAN---R 114

  Fly   344 GNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQ---VAVGHLPMSHNLISLTDCGVI 404
            |.......|.|:.|....|:|..:.||.|..|.:::|:|:   ......|.:.  :.:.|||::
 Frog   115 GKNTNGSQFFITTKAAPHLDGVHVVFGLVISGFEVIEQIESLKTDAASRPYAD--VRVIDCGLL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 37/172 (22%)
nktrXP_002939352.1 cyclophilin 7..174 CDD:381853 41/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.