DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and gpx8

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_012811797.1 Gene:gpx8 / 100145599 XenbaseID:XB-GENE-6257701 Length:209 Species:Xenopus tropicalis


Alignment Length:102 Identity:20/102 - (19%)
Similarity:41/102 - (40%) Gaps:22/102 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSSMTPYVAAVKRGPYTMTNPVYNTHNPNLVGLDGQVEDSRPKHTFNVKRQELENNYRHHQRLI- 82
            |.|.....|..||. |.:|.|:::  ...::|     .::.|.:.|.|...:.:..:...:.|: 
 Frog   116 PGSNREIEALAKRN-YGVTFPMFS--KIKILG-----PEAEPAYKFLVDSTKTKPRWNFWKYLVN 172

  Fly    83 ----------PVPTSRRTMPKIRS---HIVMNEQREL 106
                      |..|:....|::.|   .|:|.::.:|
 Frog   173 PEGQVVKYWRPDETAEIIRPEVASLVRQIIMKKKEDL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131
gpx8XP_012811797.1 Thioredoxin_like 46..198 CDD:381987 17/89 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.