DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4563 and FADD

DIOPT Version :9

Sequence 1:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_003815.1 Gene:FADD / 8772 HGNCID:3573 Length:208 Species:Homo sapiens


Alignment Length:101 Identity:24/101 - (23%)
Similarity:46/101 - (45%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 IEQIIAELPEVEHVCVVGVRDARYGDAAGALIIKKEGAE---IADQKVIDHV-------AQRVVV 497
            :.:::|.|.  .|..:..|.|...|.||||    ..|.|   .|...:.|:|       |:::.|
Human    63 LRELLASLR--RHDLLRRVDDFEAGAAAGA----APGEEDLCAAFNVICDNVGKDWRRLARQLKV 121

  Fly   498 DYKQLNAGVIFVDKFPKNANGKVMRSLAREVFEKTK 533
            ...::::   ..|::|:|...:|..||  .:::.|:
Human   122 SDTKIDS---IEDRYPRNLTERVRESL--RIWKNTE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4563NP_611913.1 CaiC 21..531 CDD:223395 23/97 (24%)
Firefly_Luc_like 49..521 CDD:213279 20/87 (23%)
FADDNP_003815.1 DED_FADD <24..82 CDD:260043 4/20 (20%)
Death_FADD 97..181 CDD:260020 12/61 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..208
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861654 Normalized mean entropy S3005
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.