DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4563 and slc27a2a

DIOPT Version :9

Sequence 1:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001020470.1 Gene:slc27a2a / 449925 ZFINID:ZDB-GENE-050706-104 Length:614 Species:Danio rerio


Alignment Length:484 Identity:101/484 - (20%)
Similarity:180/484 - (37%) Gaps:109/484 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PAIVQGLYSVTKPKIMFIDGPDYDRIKEITKEWSPKLITLTGKVE--GVTSIEDLVKPHPAEKIY 181
            ||:::.|.|:.:.::                    .::.|:|:.|  |:.::.:.|.  .|.:..
Zfish   157 PAVLEVLPSLRQQQV--------------------SVLMLSGEAETHGIINLTNQVS--CASEEA 199

  Fly   182 VPASLATGGDQI-----AVVLCSSGTAGLPKAVALSHRHI------ASTNSLCISTDVLYTSATI 235
            .|.||.   ..|     |:.:.:|||.|||||..::|..:      ...:.:| |:|::|....:
Zfish   200 PPISLR---QHITMKSPALYIYTSGTTGLPKAAVVTHEKVWMMSFLQRLSGVC-SSDIIYICLPL 260

  Fly   236 DWMTGFSITVMNLTCGFTR---IISRRTFSAETALYLVSKYKVTCLAMAPWQAYELFTSPLATSE 297
            ....||   :..|:....|   ::.:..|||........::.||.:.........|..:|...::
Zfish   261 YHSAGF---LAGLSGAIERGITVVLKSKFSASRFWDDCREHNVTVIQYIGEVMRYLCNTPEREND 322

  Fly   298 QLESLKIAFVIGGWISLALLRRAQELLPKTYVMFSYGTTETGVVTINIDHSLECSVGRLA----- 357
            :..|:::|  :|..|.....|..........|...||.||..:...|....:. |:||::     
Zfish   323 RQHSVRLA--LGNGIRAETWREFLRRFGDVRVCECYGATEGNIGFFNYTGKIG-SIGRVSAIHKL 384

  Fly   358 ----------PGMRIKIQGEDG--QQLGVNQTGEVLIDIG--LKWEGYLSNPEDT-----ATTLQ 403
                      |.....::|.||  .:....:||.::..|.  ..:|||..|...|     ....|
Zfish   385 LFPYAFLKFDPEKEEPVRGSDGLCVEAAPGETGLLVAKIHKLAPFEGYAKNSTQTEKKRLRDVFQ 449

  Fly   404 DG--WINLGDLGYFDEDNNLYLVDRKKDLLKYKSKHYWPNEIEQIIAELPEVEHVCVVGV----R 462
            .|  :.|.|||...|....|:..||..|..::|.::....|:.:|:..|..:|...|.||    .
Zfish   450 RGDMYFNTGDLILADRQGFLFFQDRIGDTFRWKGENVATTEVSEILLMLDFIEAANVYGVTVPGH 514

  Fly   463 DARYGDAAGALIIKKEGAEIADQKVIDHVAQ-----------------RVVVDYKQLNAGVIFVD 510
            :.|.|.||..|   .:|.|.......:|:..                 |:...:||:...:: .:
Zfish   515 EGRVGMAALQL---TDGMEFDGSAAYEHMKNLLPAYARPRFIRIQEELRLTGTFKQVKVQLV-QE 575

  Fly   511 KFPKNA----------NGKVMRSLAREVF 529
            .|..|:          |.:....|..|:|
Zfish   576 GFDPNSTRDRLFIMEENQQTFVPLTEEIF 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4563NP_611913.1 CaiC 21..531 CDD:223395 101/484 (21%)
Firefly_Luc_like 49..521 CDD:213279 98/474 (21%)
slc27a2aNP_001020470.1 PRK08279 20..614 CDD:236217 101/484 (21%)
AFD_class_I 74..604 CDD:302604 100/482 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.