DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4563 and ACSM2B

DIOPT Version :9

Sequence 1:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001098539.1 Gene:ACSM2B / 348158 HGNCID:30931 Length:577 Species:Homo sapiens


Alignment Length:531 Identity:115/531 - (21%)
Similarity:192/531 - (36%) Gaps:149/531 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GLTQEDRVGIIANSSTFVIP----VATACFFQATPF-------------HAVNYSREPAIVQGLY 126
            ||.:.|||.::...    :|    |...|......|             :.:..|:..|||.|..
Human   102 GLQRGDRVAVMLPR----VPEWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDE 162

  Fly   127 SVTKPKIMFIDGPDYDRIKEITKEWSPKLITLTGKVEGVTSIEDLVKPHPAEKIYVPASLATGGD 191
            .:.:...:..:.|.. |||.:..|.|         .:|..:.:.|:.    |.......:.||..
Human   163 VIQEVDTVASECPSL-RIKLLVSEKS---------CDGWLNFKKLLN----EASTTHHCVETGSQ 213

  Fly   192 QIAVVLCSSGTAGLPK-------AVALSHRHIASTNSLCISTDVLYTSATIDWMTGFSITVMNLT 249
            :.:.:..:|||:||||       ::.|..:..|....|..| |:::|.:...|       ::|: 
Human   214 EASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQAS-DIMWTISDTGW-------ILNI- 269

  Fly   250 CGFTRIISRRTFSAETALYLVSKYKVTCLAMAPWQAYELFTSPLATSEQLESLKIAFVIGGWISL 314
              ...::...|..|.|.::|:.|:                 .||...:.|.|..|..::|..|..
Human   270 --LGSLLESWTLGACTFVHLLPKF-----------------DPLVILKTLSSYPIKSMMGAPIVY 315

  Fly   315 ALLRR-----------------AQELLPKTY----------VMFSYGTTETGVVTINIDHSLECS 352
            .:|.:                 .:.|||:|.          :...||.||||         |.|.
Human   316 RMLLQQDLSSYKFPHLQNCLAGGESLLPETLENWRAQTGLDIREFYGQTETG---------LTCM 371

  Fly   353 VG---RLAPGMR--------IKIQGEDGQQLGVNQTGEVLIDIGLK---------WEGYLSNPED 397
            |.   ::.||..        :::..:.|..|.....|    |||::         :.||:.||:.
Human   372 VSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEG----DIGIRVKPIRPIGIFSGYVENPDK 432

  Fly   398 TATTLQ-DGWINLGDLGYFDEDNNLYLVDRKKDLLKYKSKHYWPNEIEQIIAELPEVEHVCVVGV 461
            ||..:: |.|: |||.|..|||.....:.|..|::........|:|:|..:.:.|.|....|:..
Human   433 TAANIRGDFWL-LGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMKHPAVVETAVISS 496

  Fly   462 RDARYGDAAGALIIKKEGAEIADQ----------KVIDHVAQRVVVDYKQLNAGVIFVDKFPKNA 516
            .|...|:...|.:|      :|.|          |.:....:.|...||.... :.||...||..
Human   497 PDPVRGEVVKAFVI------LASQFLSHDPEQLTKELQQHVKSVTAPYKYPRK-IEFVLNLPKTV 554

  Fly   517 NGKVMRSLARE 527
            .||:.|:..|:
Human   555 TGKIQRTKLRD 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4563NP_611913.1 CaiC 21..531 CDD:223395 115/531 (22%)
Firefly_Luc_like 49..521 CDD:213279 113/523 (22%)
ACSM2BNP_001098539.1 AFD_class_I 40..568 CDD:388389 115/531 (22%)
Coenzyme A binding. /evidence=ECO:0000250 469..471 0/1 (0%)
Coenzyme A binding. /evidence=ECO:0000250 540..542 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.