DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4563 and SLC27A6

DIOPT Version :9

Sequence 1:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001017372.1 Gene:SLC27A6 / 28965 HGNCID:11000 Length:619 Species:Homo sapiens


Alignment Length:512 Identity:109/512 - (21%)
Similarity:192/512 - (37%) Gaps:117/512 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DGTVLTNADMLAYATRIA-LFFKSEGLTQEDRVGIIANSSTFVIPVATACFFQATPFHAVNYSRE 118
            :|.:.|..|:...::|:| :|.....|.:.|.|.::                         .|.|
Human    76 EGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALL-------------------------MSNE 115

  Fly   119 PAIVQGLYSVTK-------------------------PKIMFIDGPDYDRIKEITKEWSPKLITL 158
            |..|...:.:.|                         |:.:.:.......::||....|.. |::
Human   116 PDFVHVWFGLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVVGADLLGTVEEILPSLSEN-ISV 179

  Fly   159 TGK----VEGVTSIEDLVKPHPAEKI----YVPASLATGGDQIAVVLCSSGTAGLPKAVALSHRH 215
            .|.    .:||.|:::.:...|.|.:    :|.:.|.:    ..:.:.:|||.|||||..:|...
Human   180 WGMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKS----TCLYIFTSGTTGLPKAAVISQLQ 240

  Fly   216 IASTNSL-----CISTDVLY-------TSATIDWMTGFSITVMNLTCGFTRIISRRTFSAETALY 268
            :...:::     |.:.|::|       :||.|..::|  ...:..||     :.::.|||.....
Human   241 VLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISG--CVELGATC-----VLKKKFSASQFWS 298

  Fly   269 LVSKYKVTCLAMAPWQAYEL--FTSPLATSEQLESLKIAFVIGGWISLALLRRAQELLPKTYVMF 331
            ...||.||......    ||  :....:..|..:..|:...||..|...:.|...:......|..
Human   299 DCKKYDVTVFQYIG----ELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLDRFGNIKVCE 359

  Fly   332 SYGTTETGVVTINIDHSLECSVGR-------LAPGMRIK--------IQGEDGQQLGV--NQTGE 379
            .|..||:.:..:|....:. ::||       |:....||        ::.|.|..:.|  .:.|.
Human   360 LYAATESSISFMNYTGRIG-AIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGEPGL 423

  Fly   380 VLIDIGLK--WEGYLSNPEDTATTL-------QDGWINLGDLGYFDEDNNLYLVDRKKDLLKYKS 435
            ::..:..|  :.||....:.|...|       .|.::|.|||...|:||.||..||..|..::|.
Human   424 LISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKG 488

  Fly   436 KHYWPNEIEQIIAELPEVEHVCVVGVRDARYGDAAG-ALIIKKEGAEIADQKVIDHV 491
            ::....|:..:|..|..::...|.||..:.|...|| |.||.|....:..:||.:.|
Human   489 ENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQV 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4563NP_611913.1 CaiC 21..531 CDD:223395 109/512 (21%)
Firefly_Luc_like 49..521 CDD:213279 109/512 (21%)
SLC27A6NP_001017372.1 PRK08279 16..619 CDD:236217 109/512 (21%)
hsFATP2a_ACSVL_like 77..609 CDD:213304 109/511 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.