DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4563 and Acsbg1

DIOPT Version :9

Sequence 1:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_599216.1 Gene:Acsbg1 / 171410 RGDID:708557 Length:721 Species:Rattus norvegicus


Alignment Length:509 Identity:106/509 - (20%)
Similarity:180/509 - (35%) Gaps:165/509 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ATRIALFFKSEGLTQEDRVGIIA-NSSTFVIPVATACFFQATPFHAVNYSREPAIVQGLYSVTKP 131
            |.::|..|...||.:...|.|:. ||..:.             |.||.......||.|:|:.:.|
  Rat   139 ARKVAKGFLKLGLERAHSVAILGFNSPEWF-------------FSAVGTVFAGGIVTGIYTTSSP 190

  Fly   132 K------------IMFIDGPDYDRIKEITKEWS--PKLITLT-------GKVEGVTSIEDLVK-- 173
            :            ::.:|  ...::::|.|.|.  |.|..:.       .|:..|.::|:|::  
  Rat   191 EACQYIAHDCRANVIVVD--TQKQLEKILKIWKDLPHLKAVVIYQEPPPKKMANVYTMEELIELG 253

  Fly   174 ---PHPAEKIYVPASLATGGDQIAVVLCSSGTAGLPKAVALSHRHIAST---------------- 219
               |..|....:.....   :|..|::.:|||.|.||.|.||..:|..|                
  Rat   254 QEVPEEALDAIIDTQQP---NQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEVQ 315

  Fly   220 ----------NSLCISTDVLYTSATIDW------------------------------------- 237
                      :.:......|:|.  |.|                                     
  Rat   316 QEVVVSYLPLSHIAAQIYDLWTG--IQWGAQVCFADPDALKGTLVNTLREVEPTSHMGVPRVWEK 378

  Fly   238 ----------MTGF----------SITV-MNLTCGFTRIISRRTFSAETALYLVSKYKVTCLAMA 281
                      .:||          |:|: .||||....:   :.|::..|.|||.......|..|
  Rat   379 IMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSNDL---KPFTSRLADYLVLARVRQALGFA 440

  Fly   282 PWQAYELFTSPLATSEQLESLKIAFVIGGWISLALLRRAQELLPKTYVMFSYGTTE-TGVVTINI 345
            ..|......:|:....|      .|.:|             |..:.|.  .||.:| ||...::.
  Rat   441 KCQKNFYGAAPMTAETQ------RFFLG-------------LNIRLYA--GYGLSESTGPHFMSS 484

  Fly   346 DHSLEC-SVGRLAPGMRIKIQGEDGQQLGVNQTGEVLIDIGLKWEGYLSNPEDTATTL-QDGWIN 408
            .::... |.||:.||.|:|:..:|...:     ||:.:.....:.|||:..:.|...: .:||::
  Rat   485 PYNYRLYSSGRVVPGCRVKLVNQDADGI-----GEICLWGRTIFMGYLNMEDKTHEAIDSEGWLH 544

  Fly   409 LGDLGYFDEDNNLYLVDRKKDL-LKYKSKHYWPNEIEQII-AELPEVEHVCVVG 460
            .||:|..|:|..||:..|.|:| :....::..|..||:.: .|||.:....::|
  Rat   545 TGDMGRLDDDGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISSAMLIG 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4563NP_611913.1 CaiC 21..531 CDD:223395 106/509 (21%)
Firefly_Luc_like 49..521 CDD:213279 106/509 (21%)
Acsbg1NP_599216.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
ACSBG_like 122..716 CDD:341256 106/509 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.