DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4563 and ACSM6

DIOPT Version :9

Sequence 1:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_997204.2 Gene:ACSM6 / 142827 HGNCID:31665 Length:480 Species:Homo sapiens


Alignment Length:314 Identity:77/314 - (24%)
Similarity:124/314 - (39%) Gaps:63/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 KLITLTGKVEGVTSIEDLVKPHPAEKIYVPASLATGGDQIAVVLCSSGTAGLPKAVALSHRHI-- 216
            ||:......:|....:.|::..|.::.|    :.|.......:..:.||.|.||.|..|...:  
Human   185 KLLVSDKSYDGWLDFKKLIQVAPPKQTY----MRTKSQDPMAIFFTKGTTGAPKMVEYSQYGLGM 245

  Fly   217 ----ASTNSLCIS-TDVLYT-----------SATI-DWMTGFSITVMNLTCGFTRIISRRTFSAE 264
                ||...:.:. ||||::           ||.: .|..|..:.:.::.          ||..|
Human   246 GFSQASRRWMDLQPTDVLWSLGDAFGGSLSLSAVLGTWFQGACVFLCHMP----------TFCPE 300

  Fly   265 TALYLVSKYKVTCLAMAPWQAYELFTSPLATSEQLESLKIAFVIGGWISLALLRRAQELLPKTYV 329
            |.|.::|::.:|.|:..|....||......||.:.:|||.....||.||..::...:. :.|..:
Human   301 TVLNVLSRFPITTLSANPEMYQELLQHKCFTSYRFKSLKQCVAAGGPISPGVIEDWKR-ITKLDI 364

  Fly   330 MFSYGTTETGVV-----TINIDHSLECSVGRLAPGMRIKIQGEDGQQLGVNQTGEVLIDIGL--- 386
            ...||.||||::     ||.:..|   |:|:..|...::|..|:...|...:.|.:.|.|.|   
Human   365 YEGYGQTETGLLCATSKTIKLKPS---SLGKPLPPYIVQIVDENSNLLPPGEEGNIAIRIKLNQP 426

  Fly   387 ---------KWEGYLSNPEDTATTLQDGWINL-GDLGYFDEDNNLYLVDRKKDL 430
                     .||.|.|        .:...:.| ||.|..|||...:...|..|:
Human   427 ASLYCPHMVSWEEYAS--------ARGHMLYLTGDRGIMDEDGYFWWSGRVDDV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4563NP_611913.1 CaiC 21..531 CDD:223395 77/314 (25%)
Firefly_Luc_like 49..521 CDD:213279 77/314 (25%)
ACSM6NP_997204.2 AFD_class_I 45..480 CDD:302604 77/314 (25%)
AMP-binding 76..472 CDD:278902 76/312 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.