DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4563 and SLC27A2

DIOPT Version :9

Sequence 1:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_003636.2 Gene:SLC27A2 / 11001 HGNCID:10996 Length:620 Species:Homo sapiens


Alignment Length:560 Identity:120/560 - (21%)
Similarity:201/560 - (35%) Gaps:123/560 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTKAVFPTFFNKETQVWSGPPRPTVYDHNTSVGQIVFNSLRCWPTNVIQITDDDGTVLTNADMLA 66
            |.:.:...|..|..|.   |.:|.          ::|.               |.| ||.|.:..
Human    51 PARTILRAFLEKARQT---PHKPF----------LLFR---------------DET-LTYAQVDR 86

  Fly    67 YATRIALFFKSE-GLTQEDRVGII-ANSSTFV--------IPVATACFFQATPFHAVNYSREPAI 121
            .:.::|...... ||.|.|.|.:: .|...:|        :..|.||         :||:.....
Human    87 RSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMAC---------LNYNIRAKS 142

  Fly   122 VQGLYSVTKPKIMFIDGPDYDRIKEITKEWSPKL---------ITLTGKVEGVTSIEDLVKPHPA 177
            :...:.....|::.: .|:   ::...:|..|.|         ::.|...:|:.|..|.|.....
Human   143 LLHCFQCCGAKVLLV-SPE---LQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVST 203

  Fly   178 EKIYVPAS------LATGGDQIAVVLCSSGTAGLPKAVALSHRHIASTNSLCI-----STDVLYT 231
            |.|  |.|      .:|.    |:.:.:|||.|||||..::|:.|.....|..     :.||:|.
Human   204 EPI--PESWRSEVTFSTP----ALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYI 262

  Fly   232 SATIDWMTGFSITVMNLTCGFTRIISRRTFSAETALYLVSKYKVTCLAMAPWQAYELFTSPLATS 296
            :..........|.:.........:..|..|||........||.||.:.........|..||...:
Human   263 TLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPN 327

  Fly   297 EQLESLKIAFVIGGWISLALLRRAQELLPKTYVMFSYGTTETGVVTINIDHSLECSVGRLAPGMR 361
            ::...:::|  :|..:...:.|:..:......:...|..||..:..:|....:. :|||:....:
Human   328 DRDHKVRLA--LGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVG-AVGRVNYLQK 389

  Fly   362 -------IK--------IQGEDGQQLGVNQTGEVLIDIGL---------KWEGYLSNPEDT-ATT 401
                   ||        ::.|:|..:.|.: |||    ||         .:.||......| ...
Human   390 KIITYDLIKYDVEKDEPVRDENGYCVRVPK-GEV----GLLVCKITQLTPFNGYAGAKAQTEKKK 449

  Fly   402 LQDG------WINLGDLGYFDEDNNLYLVDRKKDLLKYKSKHYWPNEIEQIIAELPEVEHVCVVG 460
            |:|.      :.|.|||...|.:|.:|..||..|..::|.::....|:...:..:..|:.|.|.|
Human   450 LRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYG 514

  Fly   461 VRDARYGDAAGALIIK-KEGAEIADQKVIDHVAQRVVVDY 499
            |....:....|...|| ||..|...:|:..|:|     ||
Human   515 VHVPDHEGRIGMASIKMKENHEFDGKKLFQHIA-----DY 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4563NP_611913.1 CaiC 21..531 CDD:223395 116/541 (21%)
Firefly_Luc_like 49..521 CDD:213279 113/513 (22%)
SLC27A2NP_003636.2 hsFATP2a_ACSVL_like 74..610 CDD:341261 114/524 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.