DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5-2 and AT5G04120

DIOPT Version :9

Sequence 1:NP_611911.1 Gene:Pgam5-2 / 37899 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_196032.1 Gene:AT5G04120 / 830290 AraportID:AT5G04120 Length:238 Species:Arabidopsis thaliana


Alignment Length:209 Identity:52/209 - (24%)
Similarity:81/209 - (38%) Gaps:55/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 HHWDLDKPQLQKVANGEESSALRHIILVRHGEYTRTPNG-------SHLTELGRRQ----AERTG 110
            |.|...:.:.:...:.:..|.:..|:||||||.|....|       |.|.|:|.:|    |||.|
plant     3 HEWIDAEREFKWSEDVKVESEVTEIVLVRHGETTWNAAGRIQGQIESDLNEVGLKQAVAIAERLG 67

  Fly   111 QRLREMGLSWDHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYPGDPPSKRSARSLD 175
            :..|.:.     |.:|.:.||::||::|          .|.| ..||....|  ...:|...||.
plant    68 KEERPVA-----VYSSDLKRAKDTALMI----------AKTC-FCPEVIEVP--DLKERHVGSLQ 114

  Fly   176 LAYQRDGPRIEAAFRRYFFRASPEQE----HDSY----------------------LLIVGHSNV 214
            ..|.::|...|......||.:..:.|    .:|:                      :::|.|..|
plant   115 GLYWKEGAEKEPEAYSAFFSSQNDLEIPGGGESFDQLADRSMDALEQIAKKHKGERVIVVTHGGV 179

  Fly   215 IRYLILRALQLPPA 228
            :|.:.||..|...|
plant   180 LRAIYLRITQASSA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 49/186 (26%)
AT5G04120NP_196032.1 His_Phos_1 27..219 CDD:395236 49/185 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.