DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5-2 and pgam5

DIOPT Version :9

Sequence 1:NP_611911.1 Gene:Pgam5-2 / 37899 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001007324.2 Gene:pgam5 / 492357 ZFINID:ZDB-GENE-030131-683 Length:289 Species:Danio rerio


Alignment Length:261 Identity:120/261 - (45%)
Similarity:148/261 - (56%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKGRAIE--------------PLASGAWRHHWDLDKPQ-----LQKVANGEESS---------AL 78
            |:||.:.              |.|:| |.::||..:|.     .:|.:.||..|         |.
Zfish    34 GEGRRVTETLAAVNAAHPPAWPTANG-WDYNWDKREPSSMVNGKRKESTGENGSQDAENNKPRAT 97

  Fly    79 RHIILVRHGEYTRTPNGS---HLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAMIILK 140
            |||.|:||.:|....:|.   .||.|||.|||.|||||...||.:|.::.|:|.||.|||.||.|
Zfish    98 RHIFLIRHSQYNLKGDGDKERFLTPLGREQAEFTGQRLASFGLKYDTLIHSSMTRATETANIISK 162

  Fly   141 QLNLDPLKMKRCTLLPEGTPYPGDPPS---KRSARSLDLAYQRDGPRIEAAFRRYFFRASPEQEH 202
            .  |..:::..|.||.||.|....||.   |..|    :.|..||.|||||||||..||..:|:.
Zfish   163 Y--LPGVELVSCDLLREGAPIEPVPPVTHWKPEA----VQYHEDGARIEAAFRRYIHRADAKQKE 221

  Fly   203 DSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLTVWPSGYVTLRCLGDSGFMPVTEI 267
            |||.:||.|:|||||.:.||||.||..|.||.||:||||||||.|||.|:||.||||||||..::
Zfish   222 DSYEIIVCHANVIRYFVCRALQFPPEGWLRLGLNNGSITWLTVRPSGRVSLRALGDSGFMPPDKL 286

  Fly   268 T 268
            |
Zfish   287 T 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 87/170 (51%)
pgam5NP_001007324.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..96 5/27 (19%)
HP_PGM_like 99..272 CDD:132718 93/178 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576680
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58579
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 1 1.000 - - FOG0006616
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2720
SonicParanoid 1 1.000 - - X4856
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.