DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5-2 and pgam5

DIOPT Version :9

Sequence 1:NP_611911.1 Gene:Pgam5-2 / 37899 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_012814509.2 Gene:pgam5 / 448148 XenbaseID:XB-GENE-948920 Length:279 Species:Xenopus tropicalis


Alignment Length:265 Identity:110/265 - (41%)
Similarity:149/265 - (56%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GGAQGGKGR--------AIEPLASGAWRHHWDLDKP----------------QLQKVANGEESSA 77
            |.|..||.:        ::.|.|:|.|..:||..:|                :||...|..:..|
 Frog    22 GAAAVGKSKGGPDLDILSVVPAATGQWDRNWDRREPISMVNLSKINGETGEEELQLHLNKHKPKA 86

  Fly    78 LRHIILVRHGEYT---RTPNGSHLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAMIIL 139
            .|||.|:||.:|.   :|.....||.|||.||:.||:||..:|..::|:|.|||.||:||..||.
 Frog    87 TRHIFLIRHSQYKLDGKTDFDRVLTPLGREQADLTGKRLSSLGFKYNHIVYSTMTRAKETTEIIS 151

  Fly   140 KQLNLDPLKMKRCTLLPEGTPYPGDP------PSKRSARSLDLAYQRDGPRIEAAFRRYFFRASP 198
            |.  |..:|.....||.||.|...:|      |.       .:.|..||.|||||||.:..||.|
 Frog   152 KY--LPDVKKSSSDLLREGAPIRPEPQVCHWKPD-------FVQYYEDGSRIEAAFRHFIHRADP 207

  Fly   199 EQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLTVWPSGYVTLRCLGDSGFMP 263
            :||.|||.:::.|:|||||::.|||||||.||.|::||:|||::|.:.|:|.|:||.||||||||
 Frog   208 KQEADSYEILICHANVIRYIVCRALQLPPEAWLRMSLNNGSISYLVIRPNGNVSLRMLGDSGFMP 272

  Fly   264 VTEIT 268
            ..:|:
 Frog   273 PEKIS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 80/173 (46%)
pgam5XP_012814509.2 PTZ00122 <48..276 CDD:240279 102/236 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9085
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58579
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 1 1.000 - - FOG0006616
OrthoInspector 1 1.000 - - otm47623
Panther 1 1.100 - - O PTHR20935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2720
SonicParanoid 1 1.000 - - X4856
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.