DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5-2 and CG7059

DIOPT Version :9

Sequence 1:NP_611911.1 Gene:Pgam5-2 / 37899 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651034.2 Gene:CG7059 / 42626 FlyBaseID:FBgn0038957 Length:267 Species:Drosophila melanogaster


Alignment Length:84 Identity:25/84 - (29%)
Similarity:41/84 - (48%) Gaps:16/84 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IILVRHGEYT-RTPN---GSH---LTELGRRQAERTG-QRLREMGLSWDHVVASTMPRAEETAMI 137
            ::::||||.. ...|   |.|   |:|.|.::|.... ..|.:..|.:|.|.:|.:.|:.:||.:
  Fly    21 LVILRHGESDFNIENKFCGWHDAPLSEFGVQEALTVAIPALVQSELEFDVVYSSVLSRSRQTAEL 85

  Fly   138 ILKQLNLDPLKMKRCTLLP 156
            ||.:||        |..:|
  Fly    86 ILSKLN--------CAYVP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 25/84 (30%)
CG7059NP_651034.2 HP 19..266 CDD:299704 25/84 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.