DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5-2 and Pgam5

DIOPT Version :9

Sequence 1:NP_611911.1 Gene:Pgam5-2 / 37899 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001020443.1 Gene:Pgam5 / 288731 RGDID:1312028 Length:288 Species:Rattus norvegicus


Alignment Length:282 Identity:122/282 - (43%)
Similarity:151/282 - (53%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSGGAQG--------GKGRA--------IEPLA-------SGAWRHHWDLDKP----QLQK--VA 70
            |:||:..        ||.||        .||||       .|.|..:||..:|    .|:|  |.
  Rat    14 LAGGSAAVLFSAVAVGKPRAGGDADTRTTEPLAWTGARPGHGVWDSNWDRREPLSLINLKKRNVE 78

  Fly    71 NGEE----------SSALRHIILVRHGEYTRTPNGS-----HLTELGRRQAERTGQRLREMGLSW 120
            .||:          :.|.|||.|:||.:|  ..:||     .||.|||.|||.||.||..:||.:
  Rat    79 FGEDELASRLDHYKAKATRHIFLIRHSQY--NVDGSMEKDRTLTPLGREQAELTGIRLASLGLKF 141

  Fly   121 DHVVASTMPRAEETAMIILKQLNLDPLKMKRCT-LLPEGTPYPGDPPS---KRSARSLDLAYQRD 181
            :.:|.|:|.||.||..||.|.|   |...:..| ||.||.|...|||.   |..|    :.|..|
  Rat   142 NKIVHSSMTRAVETTDIISKHL---PGVCRVSTDLLREGAPIEPDPPVSHWKPEA----VQYYED 199

  Fly   182 GPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLTVW 246
            |.|||||||.|..||..:||.|||.:.:.|:|||||::.||||.||..|.||:||:||||.|.:.
  Rat   200 GARIEAAFRNYIHRADAKQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIR 264

  Fly   247 PSGYVTLRCLGDSGFMPVTEIT 268
            |:|.|.||.|||:||||..:||
  Rat   265 PNGRVALRTLGDTGFMPPDKIT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 85/173 (49%)
Pgam5NP_001020443.1 Interaction with KEAP1. /evidence=ECO:0000250 76..81 1/4 (25%)
HP_PGM_like 98..271 CDD:132718 88/181 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58579
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 1 1.000 - - FOG0006616
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20935
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4856
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.