powered by:
Protein Alignment Pgam5-2 and tigar
DIOPT Version :9
Sequence 1: | NP_611911.1 |
Gene: | Pgam5-2 / 37899 |
FlyBaseID: | FBgn0035004 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001120569.1 |
Gene: | tigar / 100145723 |
XenbaseID: | XB-GENE-1008472 |
Length: | 275 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 22/69 - (31%) |
Similarity: | 37/69 - (53%) |
Gaps: | 12/69 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 IILVRHGEYTRTPN---------GSHLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAM 136
:.:||||| ||... ...|:|:|.:||:..|:.| ..:.:.||.:|.:.||::||.
Frog 6 LTIVRHGE-TRYNKEKLLQGQGIDEPLSEIGFKQADAVGRFL--SNVRFTHVFSSDLIRAKQTAC 67
Fly 137 IILK 140
.|::
Frog 68 AIME 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1112626at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.