DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG34171

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:246 Identity:78/246 - (31%)
Similarity:133/246 - (54%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFG 104
            ::|..:.||.::||:||:.|:...||||||:||::::|.|||:|||:||:....|:|:  |:|..
  Fly    28 HEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPK--RIVVA 90

  Fly   105 HITRLAVYDESDFRSVD--RLVVHPEYERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYG 167
            ....|....||:...||  .:::||.|.|.:.||:||::|...|:...|.:.|::: ..:::..|
  Fly    91 LCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIAIIKLKRYVKLDGHHLAPVVL-GNSSLEVG 154

  Fly   168 DTCITLG--WGQIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTA-----DHNVCTEPVGESMNC 225
            :.|.|:|  :|...|.....:.::.::|.|||...|.|...:..|     :..:|.:...:.| |
  Fly   155 NDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQM-C 218

  Fly   226 AGDMGGPLLCKGALFGLIGGHMGCAGGKAMKFLSFLYYKDWILLTIQSLSD 276
            ..|.||||.|.|.|:|:..|.:.|:....:.|....:|..|:...|....|
  Fly   219 TTDFGGPLFCDGQLYGIALGSINCSSPDPVFFSDVSFYNSWVTKIISEAVD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 72/218 (33%)
Tryp_SPc 59..250 CDD:238113 65/199 (33%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 75/234 (32%)
Tryp_SPc 38..263 CDD:304450 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H117632
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.