DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and AZU1

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:276 Identity:73/276 - (26%)
Similarity:112/276 - (40%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQILTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGD 65
            :.:|.:..||:.|:....:.|            :.|.||.|.:..:.. .:.||:.:.       
Human     4 LTVLALLAGLLASSRAGSSPL------------LDIVGGRKARPRQFP-FLASIQNQG------- 48

  Fly    66 NHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYD----ESDFR---SVDRL 123
            .|||.|.|:.:|.|:|||.|.     .|.||....||.|      .||    |...|   |:..:
Human    49 RHFCGGALIHARFVMTAASCF-----QSQNPGVSTVVLG------AYDLRRRERQSRQTFSISSM 102

  Fly   124 VVHPEYERYKKNDLAILRLSERVQ-SSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNE 187
            ..:....:...|||.:|:|..... :|:..:|||.: :.|.|..|..|...|||.....|..|..
Human   103 SENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPL-QNATVEAGTRCQVAGWGSQRSGGRLSRF 166

  Fly   188 LVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMN-CAGDMGGPLLCKGALFGLIGGHMGCAG 251
            ..:::|.:.|...|:        .:||||..:..... |.||.|.||:|:|...|:....:|..|
Human   167 PRFVNVTVTPEDQCR--------PNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCG 223

  Fly   252 GKAMKFLSFLYYKDWI 267
            .....|.....::|||
Human   224 RGPDFFTRVALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 63/222 (28%)
Tryp_SPc 59..250 CDD:238113 57/199 (29%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 68/241 (28%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.