DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and KLK10

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:235 Identity:66/235 - (28%)
Similarity:91/235 - (38%) Gaps:50/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPE 128
            |.:..|:||||....|||||||       ...|...||...|   |.:......|...|.||||:
Human    66 GLSFHCAGVLVDQSWVLTAAHC-------GNKPLWARVGDDH---LLLLQGEQLRRTTRSVVHPK 120

  Fly   129 Y---------ERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTY-----GDTCITLGWG-QI 178
            |         .|..::||.:|:|:..|      ||...:| ...:.|     ||.|...||| ..
Human   121 YHQGSGPILPRRTDEHDLMLLKLARPV------VLGPRVR-ALQLPYRCAQPGDQCQVAGWGTTA 178

  Fly   179 YQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCT------EPVGESMNCAGDMGGPLLCKG 237
            .:...|:..|....:.:..|..|:..|.....::.:|.      :|      |..|.||||:|..
Human   179 ARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDP------CQSDSGGPLVCDE 237

  Fly   238 ALFGLIG-GHMGCAGGKAMK---FLSFLYYKDWILLTIQS 273
            .|.|::. |...|  |.|..   :.....|..||...|:|
Human   238 TLQGILSWGVYPC--GSAQHPAVYTQICKYMSWINKVIRS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/207 (28%)
Tryp_SPc 59..250 CDD:238113 58/207 (28%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 64/230 (28%)
Tryp_SPc 49..269 CDD:214473 62/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.