DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG4815

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:287 Identity:65/287 - (22%)
Similarity:111/287 - (38%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPK-SNRLSRHVVSIRTKNYVRHRGDNHFC 69
            |.|.|||::..::|     |:..:.|      |.:.|: .|.:...|.|:.........|....|
  Fly     8 VRLLLILNSVRTEA-----GNREEWT------GRFHPRIYNGIKTTVESLGGVGIQLFNGRKLVC 61

  Fly    70 SGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDES-DFRSVDRLVVHPEYERYK 133
            |..|::.|.:||||||.     .::|.....|:.|.......:..: :...:.|:.:||:|.:.|
  Fly    62 SATLLTPRHILTAAHCF-----ENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMK 121

  Fly   134 -KNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTC----------ITLGWGQIYQHGPY--S 185
             ..|:|:.:..          .||   ::..:.|...|          |..|||  ::.|.:  |
  Fly   122 FIADVAVAKTK----------YPL---RSKYIGYAQLCRSVLHPRDKLIAAGWG--FEGGVWDES 171

  Fly   186 NELVY--LDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCKGALFGLIGGHMG 248
            .:..:  :.|.:.....|:|..|.....:.:|.........|.||.|||||....:.|:......
  Fly   172 RKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTFK 236

  Fly   249 CAGG-KAMKFLSFLYYKDWILLTIQSL 274
            |... |...::...||..:|..||..:
  Fly   237 CGNNEKPDVYMGVRYYAKFIKRTINRM 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 50/230 (22%)
Tryp_SPc 59..250 CDD:238113 45/206 (22%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 50/229 (22%)
Trypsin 49..256 CDD:278516 49/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.