DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and SPE

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:202 Identity:55/202 - (27%)
Similarity:86/202 - (42%) Gaps:52/202 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYD---ESDFRS----------- 119
            |.|.|::||.||||.|||..|   .::..|..:   |..||..:|   :.|..:           
  Fly   166 CGGALLNSRYVLTAGHCLASR---ELDKSGAVL---HSVRLGEWDTRTDPDCTTQMNGQRICAPK 224

  Fly   120 -----VDRLVVHPEYERY---KKNDLAILRLSERVQSSNHDVLPLLMR-----KTANVTYG-DTC 170
                 |::.::|..|...   ::||:|::|| :|:.|....|.|:.:.     :...|.|| |..
  Fly   225 HIDIEVEKGIIHEMYAPNSVDQRNDIALVRL-KRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVA 288

  Fly   171 ITLGWGQIYQHGPYSNELVYLDVILRPPSL--CQKHYDTFTA---DHNVCTEPVGESM---NCAG 227
               |||......|   ..:.|.:.:...:|  ||:.|.:|..   |..:|   .|..:   .|.|
  Fly   289 ---GWGLTENMQP---SAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMC---AGGQLGVDTCGG 344

  Fly   228 DMGGPLL 234
            |.||||:
  Fly   345 DSGGPLM 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 55/202 (27%)
Tryp_SPc 59..250 CDD:238113 55/202 (27%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 55/202 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.