DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG16710

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:278 Identity:73/278 - (26%)
Similarity:114/278 - (41%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ISGGYKPKSNRL-----------SRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCL--- 86
            |.||.:.:.|.|           ||.|.:.|..:.         |:|.|:::|.||||||||   
  Fly   106 IFGGEETQPNELPWMALILYAHRSRSVWNERLVSR---------CAGSLITNRYVLTAAHCLRIT 161

  Fly    87 --------TDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEY---ERYKKNDLAIL 140
                    ...:....||..:..:.|.......:.|.|   ||..:.|..|   |....||:|:|
  Fly   162 GLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEID---VDLSIKHRHYMVFEERPYNDIALL 223

  Fly   141 RLSERVQSSNHDVLPLLMRKT---ANVTYGDTCITL-GWGQIYQHGPYSNELVYLDVILRPPSLC 201
            ||...|:.: ..:.|:.::..   :|.::.:..:.: |||..::.| |||.|:...|..|....|
  Fly   224 RLKFPVRYT-AQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQG-YSNVLLQAYVNGRNADEC 286

  Fly   202 QKHYDTFTADH--NVCTEPVGESMNCAGDMGGPLLC---KG-----ALFGLIG-GHMGCAGG--- 252
            .....:...|.  ::|...:|.:..|.||.||||:.   :|     .|.|:.. |:..|..|   
  Fly   287 SLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYGPAA 351

  Fly   253 --KAMKFLSFLYYKDWIL 268
              |..||:      :|||
  Fly   352 YTKTSKFV------EWIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 65/253 (26%)
Tryp_SPc 59..250 CDD:238113 56/219 (26%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 70/275 (25%)
Tryp_SPc 106..362 CDD:238113 70/275 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.