DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG5255

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:212 Identity:63/212 - (29%)
Similarity:89/212 - (41%) Gaps:28/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEY-E 130
            |.|.|.::..|.::|||||...|...:     .||:.|  |:....:.|.:...||:|.|..| .
  Fly    55 HSCGGAIIDERWIITAAHCTRGRQATA-----FRVLTG--TQDLHQNGSKYYYPDRIVEHSNYAP 112

  Fly   131 RYKKNDLAILRLSERVQSSN--------HDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNE 187
            |..:||:|:|.|:|.:...|        |:.|          ..|...:..|||.:...|.....
  Fly   113 RKYRNDIALLHLNESIVFDNATQPVELDHEAL----------VPGSRLLLTGWGTLSLGGDVPAR 167

  Fly   188 LVYLDVILRPPSLCQKHYDTFTADH--NVCTEPVGESMNCAGDMGGPLLCKGALFGLIGGHMGCA 250
            |..|:|...|...|:..:|..|...  :|||........|.||.||||:..|.|..|:...:.||
  Fly   168 LQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCA 232

  Fly   251 GGKAMKFLSFLYYKDWI 267
            .|......|..||.|:|
  Fly   233 KGYPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 55/193 (28%)
Tryp_SPc 59..250 CDD:238113 55/193 (28%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 62/210 (30%)
Tryp_SPc 30..252 CDD:238113 63/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.