DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG31326

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:239 Identity:61/239 - (25%)
Similarity:105/239 - (43%) Gaps:58/239 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GDNHFCSGVLVSSRAVLTAAHCLTDRYKA---SMNPRGIRVVFGHITRLAVYDESDFRSVDRLVV 125
            |....|.|.|:|:..||:||||    ::|   .:....:.|..|..| ||::.:.:||.|.:|::
  Fly   299 GPAFICGGTLISTSTVLSAAHC----FRAPGRDLPASRLAVSLGRNT-LAIHSDGEFRGVSQLII 358

  Fly   126 HP--EYERYKKNDLAILRLSERVQSSNHDVLPLLMRKTAN---VTYGDTCITLGWG--------- 176
            |.  :::::.:.|||::||.|.|:.::: ::|:.:..|:|   :..|......|||         
  Fly   359 HENFQFKQFTEADLALVRLDEPVRYTDY-IVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNT 422

  Fly   177 --------QIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPL 233
                    .|......:.||.:  |:::|.|||.|              ..|.. .||.|.||||
  Fly   423 EVSKVTDLNIVSEANCALELPH--VLVQPSSLCAK--------------KTGAG-PCASDGGGPL 470

  Fly   234 LCK----GALFGLIGGHM------GCAGGKAMKFLSFLYYKDWI 267
            :.:    ..|.|:|.|.:      .|...|...|.....:.:|:
  Fly   471 MLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 57/220 (26%)
Tryp_SPc 59..250 CDD:238113 57/220 (26%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 61/239 (26%)
Tryp_SPc 277..514 CDD:214473 60/237 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.