DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG8870

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:270 Identity:69/270 - (25%)
Similarity:111/270 - (41%) Gaps:56/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCL------------ 86
            ||:.|    ..|.||:.:|.              .|.|.|:::..|||||||:            
  Fly   100 MLLYG----NKNNLSQKLVP--------------KCGGSLINNWYVLTAAHCVEYPFMDYPYALK 146

  Fly    87 ---TDRYKASMNP-RGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYERYKK--NDLAILRLSER 145
               ...:..|.|| |.|  |.|......:|.|.:   ||:::.|.::.|.::  ||:|::||...
  Fly   147 TVRLGEHNTSTNPDRAI--VNGRRQYAPLYMEIE---VDQIITHEQFNRGRRLINDIALVRLKFP 206

  Fly   146 VQSSNHDVLPL-LMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDTFT 209
            |:.: ..:.|: |.|......:.......||..:.| |..|..|:...:..|.|.:|:.:|| |.
  Fly   207 VRYT-RAIQPICLPRAQKLAAHKRKFQASGWPDMGQ-GIASEVLLRSFIAERHPDVCKSNYD-FN 268

  Fly   210 ADHNVCTEPVGESMNCAGDMGGPLL---CKGAL-----FGLIG-GHMGCA--GGKAMKFLSFLYY 263
            ....:|...:..:....||.||||:   .:|.:     .|:|. |...|.  ..|...:....|:
  Fly   269 LGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYF 333

  Fly   264 KDWILLTIQS 273
            .:||...:||
  Fly   334 FEWIKSKLQS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 60/241 (25%)
Tryp_SPc 59..250 CDD:238113 55/218 (25%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 67/265 (25%)
Tryp_SPc 93..337 CDD:214473 65/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.