DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15873 and CG13318

DIOPT Version :9

Sequence 1:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:231 Identity:58/231 - (25%)
Similarity:93/231 - (40%) Gaps:36/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRS--------VD 121
            |.:...|.|::::.||||||.:   |...:....:        ||..:|.:....        :.
  Fly   185 DVYLGGGALITAQHVLTAAHKV---YNLGLTYFKV--------RLGEWDAASTSEPIPAQDVYIS 238

  Fly   122 RLVVHPEYE-RYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQ--IYQHGP 183
            .:.|:|.:. ...:||:|||:||..|..::...:..:...|.:.. |..|...|||:  ....|.
  Fly   239 NVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTSFV-GQRCWVAGWGKNDFGATGA 302

  Fly   184 YSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPV------GESMN--CAGDMGGPLLC--KGA 238
            |......:||.|.|.:.||..........:....|.      ||:..  |.||.|.||:|  .|.
  Fly   303 YQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGV 367

  Fly   239 LF--GLIGGHMGCA-GGKAMKFLSFLYYKDWILLTI 271
            .:  ||:...:||| .|....:::...|..||..|:
  Fly   368 WYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 51/207 (25%)
Tryp_SPc 59..250 CDD:238113 51/207 (25%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 57/228 (25%)
Tryp_SPc 169..399 CDD:214473 55/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.